Antibodies

Jump to Filters
View as table Download
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA372959

USD 380.00

4 Weeks

NTF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NTF3
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA328680

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA328681

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-proNT-3

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA342144

USD 375.00

5 Days

Rabbit polyclonal Anti-Ntf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY
NTF3 Rabbit Polyclonal Antibody
TA364535

USD 380.00

4 Weeks

NTF3 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NTF3
NTF3 Rabbit Polyclonal Antibody
TA368723

USD 380.00

4 Weeks

NTF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NTF3