Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

CAT#: TA342144

Rabbit polyclonal Anti-Ntf3 Antibody

Product Images

WB Suggested Anti-Ntf3 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: neurotrophin 3
• Database Link:
  NP_001096124
  Entrez Gene 81737 Rat
  UniProt ID P20783
• Background: a neuronal survival protein [RGD, Feb 2006]. Transcript Variant:This variant (1) isThe longest transcript and encodesThe longer isoform (1). Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC070504.1, CK365049.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369736, SRS369739 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: HDNF; NGF-2; NGF2; NT-3; NT3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: MAPK signaling pathway, Neurotrophin signaling pathway