Rabbit Polyclonal Anti-ACAT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Murine, Rat, Porcine, Ovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
ACAT2 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ACAT2 |
ACAT2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACAT2 |
ACAT2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACAT2 |
ACAT2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human ACAT2 (NP_005882.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
