ACAT2 Rabbit Polyclonal Antibody

CAT#: TA331169

Rabbit Polyclonal Anti-ACAT2 Antibody

Product Images

WB Suggested Anti-ACAT2 Antibody Titration: 1.0ug/ml; Positive Control: K562 cell lysateSLC4A1 is supported by BioGPS gene expression data to be expressed in K562

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: acetyl-CoA acetyltransferase 2
• Database Link:
  NP_005882
  Entrez Gene 39 Human
  UniProt ID Q9BWD1
• Background: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
• Synonyms: acetoacetyl Coenzyme A thiolase; acetyl-Coenzyme A acetyltransferase 2; cytosolic acetoacetyl-CoA thiolase; OTTHUMP00000017527
• Note: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Tryptophan metabolism, Valine, leucine and isoleucine degradation