Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to Coronin 1B (coronin, actin binding protein, 1B)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 213 of Coronin 1B (Uniprot ID#Q9BR76) |
Rabbit Polyclonal Anti-CORO1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1B Antibody is: synthetic peptide directed towards the C-terminal region of Human CORO1B. Synthetic peptide located within the following region: STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ |
CORO1B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CORO1B |
CORO1B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CORO1B |
CORO1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 380-489 of human CORO1B (NP_065174.1). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CORO1B
Clonalities
- Polyclonal