Rabbit Polyclonal Anti-BAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the C terminal of human BAT1. Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI |
Rabbit Polyclonal Anti-BAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the N terminal of human BAT1. Synthetic peptide located within the following region: MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF |
UAP56/DDX39B Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human UAP56/UAP56/DDX39B (NP_004631.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
