UAP56 (DDX39B) Rabbit Polyclonal Antibody

CAT#: TA341568

Rabbit Polyclonal Anti-BAT1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DDX39B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the C terminal of human BAT1. Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name DEAD-box helicase 39B
Background This gene encodes a member ofThe DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing.The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export fromThe nucleus toThe cytoplasm.This gene belongs to a cluster of genes localized inThe vicinity ofThe genes encoding tumor necrosis factor alpha and tumor necrosis factor beta.These genes are all withinThe human major histocompatibility complex class III region. Mutations inThis gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs betweenThis gene andThe upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. [provided by RefSeq, Feb 2011]
Synonyms BAT1; D6S81E; UAP56
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.