IL34 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL34 |
IL34 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL34 |
Rabbit Polyclonal IL-34 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IL-34 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-34. |
Rabbit Polyclonal IL-34 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IL-34 antibody was raised against a 13 amino acid peptide from near the center of human IL-34. |
Rabbit Polyclonal Anti-IL34 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL34 Antibody is: synthetic peptide directed towards the N-terminal region of Human IL34. Synthetic peptide located within the following region: ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP |
IL34 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL34 |