Interleukin 34 (IL34) Rabbit Polyclonal Antibody

CAT#: TA332159

Rabbit Polyclonal Anti-IL34 Antibody

Product Images

Host: Rabbit; Target Name: IL34; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IL34 Antibody is: synthetic peptide directed towards the N-terminal region of Human IL34. Synthetic peptide located within the following region: ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: interleukin 34
• Database Link:
  NP_001166242
  Entrez Gene 146433 Human
  UniProt ID Q6ZMJ4
• Background: Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor.
• Synonyms: C16orf77; IL-34
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%