Antibodies

View as table Download

Rabbit Polyclonal LMO2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human LMO2 protein (within residues 1-100). [Swiss-Prot# P25791]

Rabbit Polyclonal anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS

Rabbit Polyclonal Anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE

Lmo2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

LMO2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1).
Modifications Unmodified

LMO2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1).
Modifications Unmodified

LMO2 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human LMO2