Antibodies

View as table Download

NOG rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NOG

Rabbit Polyclonal Anti-NOG Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NOG antibody: synthetic peptide directed towards the middle region of human NOG. Synthetic peptide located within the following region: GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI

Rabbit Polyclonal Noggin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising an internal sequence of the human Noggin protein. Sequence is 100% conserved in rat and mouse (NP_005441).

Rabbit Polyclonal Noggin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising residues 156-170 [PVLYAWNDLGSRFWP] of the human Noggin protein

NOG rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NOG

NOG Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-232 of human NOG (NP_005441.1).
Modifications Unmodified