Rabbit Polyclonal Anti-NUBPL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the C-terminal region of Human NUBPL. Synthetic peptide located within the following region: AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR |
Rabbit Polyclonal Anti-NUBPL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NUBPL Antibody is: synthetic peptide directed towards the N-terminal region of Human NUBPL. Synthetic peptide located within the following region: MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRT |
Germany
Japan
United Kingdom
China