Antibodies

View as table Download

Rabbit polyclonal antibody to RARRES3 (retinoic acid receptor responder (tazarotene induced) 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 69 and 164 of RARRES3 (Uniprot ID#Q9UL19)

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RARRES3

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RARRES3 antibody: synthetic peptide directed towards the middle region of human RARRES3. Synthetic peptide located within the following region: FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV