Rabbit Polyclonal Antibody against PYGM (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM. |
Rabbit Polyclonal Anti-Pygm Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pygm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI |
Rabbit Polyclonal Anti-PYGM Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PYGM antibody was raised against synthetic 10 amino acid peptide from internal region of human PYGM / Phosphorylase b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Sheep, Dog, Bovine, Elephant, Panda, Rabbit, Armadillo (100%); Shrew, Bat, Pig, Platypus (90%); Xenopus, Penicillium (80%). |
Rabbit Polyclonal Anti-PYGM Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PYGM antibody was raised against synthetic 14 amino acid peptide from C-terminus of human PYGM / Phosphorylase b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey (100%); Galago, Marmoset, Mouse, Rat, Hamster, Rabbit, Pig, Armadillo (93%); Dog, Panda, Horse (86%). |
PYGM rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PYGM |
PYGM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PYGM (NP_005600.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
