Antibodies

View as table Download

Rabbit Polyclonal RNF20 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RNF20 antibody was raised against a 19 amino acid peptide near the amino terminus of human RNF20.

Rabbit Polyclonal Anti-RNF20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the N terminal of human RNF20. Synthetic peptide located within the following region: LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS

Rabbit Polyclonal Anti-RNF20 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF20 antibody: synthetic peptide directed towards the middle region of human RNF20. Synthetic peptide located within the following region: KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEI

Rabbit Polyclonal Anti-RNF20 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RNF20

RNF20 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RNF20

RNF20 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF20 (NP_062538.5).
Modifications Unmodified