Antibodies

View as table Download

Rabbit Polyclonal Anti-SF3B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI

Rabbit Polyclonal Anti-SF3B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT

Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393)

SF3B3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1053-1082 amino acids from the C-terminal region of Human SF3B3.

Goat Polyclonal Antibody against SAP130 / SF3B3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VSKKLEDIRTRYAF, from the C Terminus of the protein sequence according to NP_036558.3.

SF3B3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SF3B3

SF3B3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SF3B3

SF3B3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SF3B3

SF3B3/SAP130 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 948-1217 of human SF3B3/SAP130 (NP_036558.3).
Modifications Unmodified