Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TBC1D4 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TBC1D4 |
Goat Polyclonal Antibody against TBC1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DDPEKIEERKKSK, from the internal region of the protein sequence according to NP_055647.2. |
Rabbit Polyclonal TBC1D4 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TBC1D4 antibody was raised against an 19 amino acid peptide near the carboxy terminus of human TBC1D4 . |
Rabbit Polyclonal Anti-TBC1D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBC1D4 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D4. Synthetic peptide located within the following region: EMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLEKLER |
Rabbit Polyclonal Anti-TBC1D4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TBC1D4 |
TBC1D4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TBC1D4. |
Phospho-TBC1D4-S588 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S588 of human TBC1D4 (NP_055647.2). |
| Modifications | Phospho S588 |
Phospho-TBC1D4-T642 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T642 of human TBC1D4 (NP_055647.2). |
| Modifications | Phospho T642 |
TBC1D4 (phospho-T642) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human TBC1D4 around the phosphorylation site of Threonine 642. |
TBC1D4 phospho T642 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TBC1D4 [p Thr642] affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide surrounding the pT649 site of human TBC1D4 [p Thr642]. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TBC1D4
Clonalities
- Polyclonal