TBC1D4 Rabbit Polyclonal Antibody

CAT#: TA343344

Rabbit Polyclonal Anti-TBC1D4 Antibody

Product Images

WB Suggested Anti-TBC1D4 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBC1D4 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D4. Synthetic peptide located within the following region: EMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLEKLER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 146 kDa
• Gene Name: TBC1 domain family member 4
• Database Link:
  NP_055647
  Entrez Gene 9882 Human
  UniProt ID O60343
• Background: TBC1D4 may act as a GTPase-activating protein for RAB2A, RAB8A, RAB10 and RAB14. Isoform 2 promotes insulin-induced glucose transporter SLC2A4/GLUT4 translocation at the plasma membrane, thus increasing glucose uptake.
• Synonyms: AS160; NIDDM5
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 83%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%