Antibodies

Jump to Filters
View as table Download
CCRL2 (Center) Rabbit Polyclonal Antibody
AP50828PU-N

USD 450.00

2 Weeks

CCRL2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 205-234 amino acids from the Central region of human CCRL2
CCRL2 Rabbit Polyclonal Antibody
TA334723

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCRL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCRL2 antibody: synthetic peptide directed towards the N terminal of human CCRL2. Synthetic peptide located within the following region: LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL