Rabbit anti-CREM Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CREM |
Rabbit anti-CREM Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CREM |
Rabbit polyclonal anti-CREM antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREM. |
CREM (C-term) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 277~307 amino acids from the C-terminal region of human CREM |
Rabbit Polyclonal Anti-CREM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREM antibody: synthetic peptide directed towards the N terminal of human CREM. Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR |
Goat Polyclonal Antibody against CREM
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence LETLKDICSPKTDY, from the C Terminus of the protein sequence according to NP_853549.1; NP_874387.1; NP_874388.1; NP_874393.1; NP_874394.1; NP_877570.1; NP_877571.1; NP_877572.1; NP_877573.1; NP_878270.1; NP_898883.1. |
Rabbit Polyclonal Anti-Crem Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Crem antibody is: synthetic peptide directed towards the C-terminal region of Rat Crem. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE |