Rabbit Polyclonal Anti-DBP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DBP antibody: synthetic peptide directed towards the middle region of human DBP. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-DBP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DBP antibody: synthetic peptide directed towards the C terminal of human DBP. Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK |
Rabbit Polyclonal Anti-DBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DBP antibody: synthetic peptide directed towards the N terminal of human DBP. Synthetic peptide located within the following region: PKEPASCLLKEKERKAALPAATTPGPGLETAGPADAPAGAVVGGGSPRGR |
Rabbit Polyclonal anti-DBP antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DBP antibody: synthetic peptide directed towards the middle region of human DBP. Synthetic peptide located within the following region: SSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLA |
DBP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DBP |
DBP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human DBP (NP_001343.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
