Rabbit Polyclonal Anti-ECHDC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR |
Rabbit Polyclonal Anti-ECHDC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI |
ECHDC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human ECHDC2 (NP_001185890.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China