Antibodies

Jump to Filters
View as table Download
GPR40 (FFAR1) Rabbit Polyclonal Antibody
AP01314PU-N

USD 370.00

2 Weeks

GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40.
GPR40 (FFAR1) Rabbit Polyclonal Antibody
TA317591

USD 425.00

5 Days

GPR40 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Tested:
Conjugation Unconjugated
Immunogen FFAR1 / GPR40 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR40. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Mouse, Hamster, Pig (84%).
GPR40 (FFAR1) Rabbit Polyclonal Antibody
AP23088PU-N

USD 440.00

2 Weeks

GPR40 (FFAR1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide containing a sequence corresponding to a region within amino acids 239 and 300 of Human GPR40
GPR40 (FFAR1) Goat Polyclonal Antibody
TA303026

USD 375.00

In Stock

Goat Polyclonal Antibody against GPR40

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1.
Ffar1 Rabbit Polyclonal Antibody
TA328808

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Free Fatty Acid Receptor 1 (extracellular)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide, (C)NVASFINPDLEGSWRK corresponding to amino acid residues 244-259 of rat free fatty acid receptor 1.
GPR40 (FFAR1) Rabbit Polyclonal Antibody
TA330390

USD 375.00

5 Days

Rabbit Polyclonal Anti-FFAR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
GPR40 (FFAR1) (C-term) Rabbit Polyclonal Antibody
AP51649PU-N

USD 450.00

2 Weeks

GPR40 (FFAR1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 280-300 amino acids from the C-terminal region of human FFAR1
GPR40 (FFAR1) Rabbit Polyclonal Antibody
TA376210

USD 220.00

3 Weeks

FFAR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human FFAR1 (NP_005294.1).
Modifications Unmodified