Antibodies

Jump to Filters
View as table Download
IFNE1 (IFNE) Rabbit Polyclonal Antibody
TA331574

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFNE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS
IFNE Rabbit Polyclonal Antibody
TA384484

USD 380.00

4 Weeks

Interferon epsilon Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human IFNE. AA range:159-208