Antibodies

Jump to Filters
View as table Download
POLDIP1 (KCTD13) Rabbit Polyclonal Antibody
TA338781

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCTD13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD13 antibody: synthetic peptide directed towards the N terminal of human KCTD13. Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
KCTD13 Rabbit Polyclonal Antibody
TA366212

USD 380.00

4 Weeks

KCTD13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD13
KCTD13 Rabbit Polyclonal Antibody
TA370564

USD 380.00

4 Weeks

KCTD13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD13