Rabbit polyclonal anti-MEF2B antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEF2B. |
Rabbit polyclonal anti-MEF2B antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEF2B. |
Rabbit Polyclonal Anti-MEF2B Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-MEF2B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL |
MEF2B Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MEF2B |
MEF2B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1). |
Modifications | Unmodified |
MEF2B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2B (NP_005910.1). |
Modifications | Unmodified |