Antibodies

View as table Download

Rabbit Polyclonal Anti-MSI2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Rabbit Polyclonal Anti-MSI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM

Rabbit Polyclonal Anti-MSI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the middle region of human MSI2. Synthetic peptide located within the following region: YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI

Rabbit Polyclonal MSI2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MSI2 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human MSI2.

Goat Anti-MSI2 (aa33-43) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SPDSLRDYFSK, from the internal region of the protein sequence according to NP_620412.1; NP_733839.1.

Goat Anti-MSI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QGTSGSANDSQHD-C, from the N Terminus of the protein sequence according to NP_620412.1.

MSI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MSI2

MSI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MSI2