Antibodies

View as table Download

B MyB (MYBL2) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MYBL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK

Goat Polyclonal Antibody against MYBL2

Applications WB
Reactivities Rat
Immunogen Peptide with sequence C-QEKARQLLGRLKPSH, from the C Terminus of the protein sequence according to NP_002457.1.