Antibodies

Jump to Filters
View as table Download
NIT2 Rabbit Polyclonal Antibody
TA339349

USD 375.00

5 Days

Rabbit Polyclonal Anti-NIT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NIT2 antibody: synthetic peptide directed towards the middle region of human NIT2. Synthetic peptide located within the following region: VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP
NIT2 Rabbit Polyclonal Antibody
TA321871

USD 345.00

In Stock

Anti-NIT2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-276 amino acids of Human itrilase family, member 2
NIT2 Rabbit Polyclonal Antibody
TA321872

USD 345.00

In Stock

Anti-NIT2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-276 amino acids of Human itrilase family, member 2