Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFSF13B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFSF13B

Rabbit Polyclonal Anti-Orai1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KFLPLKRQAGQPS, corresponding to amino acid residues 200-212 of mouse Orai1. 2nd extracellular loop.

Rabbit Polyclonal ORAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ORAI1 antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human ORAI1. The immunogen is located within the last 50 amino acids of ORAI1.

Rabbit Polyclonal ORAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ORAI1 antibody was raised against a 18 amino acid peptide from near the amino terminus of human ORAI1.

ORAI1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 152~181 amino acids from the Center region of human ORAI1

Rabbit Polyclonal Anti-Human Orai1 (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)KKQPGQPRPTSK, corresponding to amino acid residues 203-214 of human Orai1. 2nd extracellular loop.

Goat Anti-ORAI1 / CRACM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KKQPGQPRPTSKP, from the internal region of the protein sequence according to NP_116179.2.

Rabbit Polyclonal Anti-ORAI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the N terminal of human ORAI1. Synthetic peptide located within the following region: HPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVT

Rabbit Polyclonal Anti-ORAI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the middle region of human ORAI1. Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP

Rabbit Polyclonal Anti-ORAI1(L1) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ORAI1(L1)

Rabbit Polyclonal Anti-ORAI1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ORAI1

ORAI1(L1) rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ORAI1(L1)

ORAI1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-301 of human ORAI1 (NP_116179.2).
Modifications Unmodified