Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-P2RY13 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY13. |
Rabbit Polyclonal Anti-P2RY13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK |
P2Y13 / P2RY13 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | P2Y13 / P2RY13 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Bat (94%); Dog, Pig (81%). |
P2Y13 / P2RY13 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | P2Y13 / P2RY13 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Elephant, Bovine, Rabbit (94%); Mouse, Bat, Horse (88%); Rat, Hamster, Dog, Chicken, Platypus (82%). |
P2RY13 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- P2RY13
Clonalities
- Polyclonal