GPR86 (P2RY13) Rabbit Polyclonal Antibody

CAT#: TA337752

Rabbit Polyclonal Anti-P2RY13 Antibody

Product Images

WB Suggested Anti-P2RY13 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: purinergic receptor P2Y13
• Database Link:
  NP_795713
  Entrez Gene 53829 Human
  UniProt ID Q9BPV8
• Background: The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP.
• Synonyms: FKSG77; GPCR1; GPR86; GPR94; P2Y13; SP174
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Mouse: 86%; Rabbit: 79%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction