Rabbit Polyclonal Anti-PDIK1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH |
Rabbit Polyclonal Anti-PDIK1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE |
Germany
Japan
United Kingdom
China