Antibodies

View as table Download

Rabbit Polyclonal Anti-PEBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEBP1

Rabbit anti-PEBP1 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PEBP1

Rabbit Polyclonal Anti-PEBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEBP1 antibody: synthetic peptide directed towards the C terminal of human PEBP1. Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

PBP (PEBP1) (175-187) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine
Immunogen Synthetic peptide from C-term of human PEBP1

PBP (PEBP1) (70-83) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from an internal region of human PEBP1

Rabbit polyclonal PEBP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PEBP1.

Goat Polyclonal Antibody against PEBP1

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DYVPKLYEQLSGK, from the C Terminus of the protein sequence according to NP_002558.1.

Goat Polyclonal Antibody against PEBP1 / RKIP (Internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPDAPSRKDPKYRE, from the internal region of the protein sequence according to NP_002558.1.

PEBP1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEBP1