Antibodies

Jump to Filters
View as table Download
RCE1 Rabbit Polyclonal Antibody
TA335719

USD 310.00

5 Days

Rabbit Polyclonal Anti-RCE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCE1 Antibody: synthetic peptide directed towards the N terminal of human RCE1. Synthetic peptide located within the following region: WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF
RCE1 Rabbit Polyclonal Antibody
TA380813

USD 220.00

3 Weeks

RCE1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RCE1.