Antibodies

View as table Download

Rabbit polyclonal anti-RHO (rhodopsin) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RHO.

Rabbit Polyclonal Anti-RHO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHO antibody: synthetic peptide directed towards the C terminal of human RHO. Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE

Rhodopsin Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1).
Modifications Unmodified