Antibodies

Jump to Filters
View as table Download
SENP5 Rabbit Polyclonal Antibody
TA311669

USD 345.00

In Stock

Rabbit polyclonal anti-SENP5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human SENP5.
SENP5 Rabbit Polyclonal Antibody
TA347493

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SENP5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP5 Antibody: A synthesized peptide derived from human SENP5
SENP5 Rabbit Polyclonal Antibody
AP06459PU-N

USD 370.00

2 Weeks

SENP5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
SENP5 Rabbit Polyclonal Antibody
TA329775

USD 375.00

5 Days

Rabbit polyclonal Anti-SENP5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
SENP5 Rabbit Polyclonal Antibody
TA350400

USD 345.00

In Stock

Rabbit Polyclonal Anti-SENP5 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SENP5
SENP5 Rabbit Polyclonal Antibody
TA365008

USD 380.00

4 Weeks

SENP5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SENP5