Antibodies

View as table Download

Rabbit Polyclonal Anti-NKCC1 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RRQAMKEMSIDQAK, corresponding to amino acid residues 828-841 of human NKCC1. 6th extracellular loop.

Rabbit Polyclonal Anti-SLC12A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC12A2 Antibody: synthetic peptide directed towards the C terminal of human SLC12A2. Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

NKCC1 (SLC12A2) (769-783) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Chicken, Equine, Human, Porcine
Immunogen Synthetic peptide from an internal region of human SLC12A2 / NKCC1 (NP_001037.1)

Rabbit Polyclonal Anti-SLC12A2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 19 amino acid peptide from N-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (89%); Monkey, Marmoset, Ferret, Dog, Panda (84%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 18 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bovine, Pig (89%); Ferret, Dog, Bat, Panda (83%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Bovine, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Elephant, Lizard (94%); Opossum, Chicken (88%); Turkey (82%).

Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC12A2 / NKCC1 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum, Guinea pig (100%); Bat (93%).

SLC12A2 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC12A2

SLC12A2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1).
Modifications Unmodified