Rabbit Polyclonal Anti-TRIB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
Goat Anti-Trib1 (mouse) (aa304-317) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PEHVSPKARCLIRS, from the internal region of the protein sequence according to NP_653132.1. |
Rabbit Polyclonal Anti-TRIB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the C terminal of human TRIB1. Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF |
TRIB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 203-372 of human TRIB1 (NP_079471.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
