Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-UBE2D2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human UBE2D2. |
Antibodies
View as table Download
Rabbit Polyclonal anti-EDG8 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDG8 antibody: synthetic peptide directed towards the N terminal of human EDG8. Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
UBE2D2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 111-140 amino acids from the C-terminal region of human UBE2D2 |
UBE2D2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D2 (NP_003330.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UBE2D2
Clonalities
- Polyclonal