Antibodies

Jump to Filters
View as table Download
UBE2D4 Rabbit Polyclonal Antibody
TA330654

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBE2D4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2D4 antibody is: synthetic peptide directed towards the C-terminal region of Human UBE2D4. Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY
UBE2D4 Rabbit Polyclonal Antibody
TA383008

USD 220.00

3 Weeks

UBE2D4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D4 (NP_057067.1).
Modifications Unmodified