YY1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human YY1 |
YY1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human YY1 |
Rabbit polyclonal anti-YY1 antibody(N-term), Loading control
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This YY1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 74-104 amino acids from the N-terminal region of human YY1. |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: GADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGEN |
Rabbit Polyclonal Anti-YY1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the N terminal of human YY1. Synthetic peptide located within the following region: MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD |
YY1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YY1 |
YY1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human YY1 |
YY1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human YY1 |
YY1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human YY1 |
YY1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human YY1 |
YY1 Rabbit polyclonal Antibody
Applications | ChIP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human YY1 (NP_003394.1). |
Modifications | Unmodified |
YY1 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human YY1 |