Rabbit Polyclonal Anti-ZNF286 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the C terminal of human ZNF286. Synthetic peptide located within the following region: GKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP |
Rabbit Polyclonal Anti-ZNF286A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF286A antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF286A. Synthetic peptide located within the following region: KSNLMKKQRTYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNEC |
Rabbit Polyclonal Anti-ZNF286 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the N terminal of human ZNF286. Synthetic peptide located within the following region: GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK |
Rabbit Polyclonal Anti-ZNF286A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286A antibody: synthetic peptide directed towards the N terminal of human ZNF286A. Synthetic peptide located within the following region: SSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALE |
ZNF286A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human ZNF286A (NP_065703.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China