Antibodies

View as table Download

Rabbit Polyclonal Anti-LAMTOR2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LAMTOR2 antibody was raised against an 18 amino acid peptide near the center of human LAMTOR2.

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3. Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL

Rabbit anti-ANGPTL3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANGPTL3

Carrier-free (BSA/glycerol-free) ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ANGPTL3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of Human Angiopoietin-related protein 3

ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANGPTL3 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated