Antibodies

View as table Download

Rabbit Polyclonal Antibody against FAU (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FAU.

Rabbit Polyclonal Antibody against FAU (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-59 amino acids from the C-terminal region of human FAU.

Rabbit Polyclonal Anti-FAU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU. Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS