Antibodies

Jump to Filters
View as table Download
GJB6 Rabbit Polyclonal Antibody
TA321785

USD 345.00

4 Weeks

Anti-GJB6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 230-245 amino acids of Human Gap junction beta-6 protein
GJB6 Rabbit Polyclonal Antibody
TA321786

USD 345.00

In Stock

Anti-GJB6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 230-245 amino acids of Human Gap junction beta-6 protein
GJB6 Rabbit Polyclonal Antibody
TA341667

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB6 antibody: synthetic peptide directed towards the middle region of human GJB6. Synthetic peptide located within the following region: CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP
GJB6 Rabbit Polyclonal Antibody
TA321787

USD 345.00

In Stock

Anti-GJB6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 247-261 amino acids of Human gap junction protein, beta 6, 30kDa
GJB6 Rabbit Polyclonal Antibody
TA321788

USD 345.00

In Stock

Anti-GJB6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 247-261 amino acids of Human gap junction protein, beta 6, 30kDa