Rabbit Polyclonal JMJD2b Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD2b antibody: human JMJD2b (Jumonji Domain containing 2b), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein. |
Rabbit Polyclonal Anti-JMJD2B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD2B antibody: synthetic peptide directed towards the middle region of human JMJD2B. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-JMJD2B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD2B antibody: synthetic peptide directed towards the middle region of human JMJD2B. Synthetic peptide located within the following region: SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV |
Rabbit polyclonal anti-JHD3B (KDM4B / JMJD2B) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human JHD3B. |
Germany
Japan
United Kingdom
China
