Antibodies

Jump to Filters
View as table Download
MFI2 (MELTF) Rabbit Polyclonal Antibody
TA590214

USD 409.00

In Stock

Rabbit Polyclonal MFI2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
MFI2 (MELTF) Rabbit Polyclonal Antibody
TA590215

USD 409.00

In Stock

Rabbit Polyclonal MFI2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
MFI2 (MELTF) Rabbit Polyclonal Antibody
TA342916

USD 375.00

5 Days

Rabbit Polyclonal Anti-MFI2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
MFI2 (MELTF) Rabbit Polyclonal Antibody
TA317015

USD 425.00

5 Days

MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit
Conjugation Unconjugated
Immunogen MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%).