MFI2 (MELTF) Rabbit Polyclonal Antibody

CAT#: TA342916

Rabbit Polyclonal Anti-MFI2 Antibody

Product Images

WB Suggested Anti-MFI2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Sample Type: HeLa cells Primary Antibody Dilution: 1:50 Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution: 1:800 Color/Signal Descriptions: Green: MFI2 Blue: DAPI Gene Name: MFI2

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: IF, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: melanotransferrin
• Database Link:
  NP_005920
  Entrez Gene 4241 Human
  UniProt ID P08582
• Background: MFI2 is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified.
• Synonyms: CD228; MAP97; MTf; MTF1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome