Antibodies

Jump to Filters
View as table Download
NPY2R Rabbit Polyclonal Antibody
TA314282

USD 345.00

4 Weeks

Rabbit polyclonal anti-NPY2R antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY2R.
NPY2R Rabbit Polyclonal Antibody
TA329176

USD 375.00

5 Days

Rabbit Polyclonal anti-NPY2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV
NPY2R Rabbit Polyclonal Antibody
TA323533

USD 345.00

4 Weeks

Anti-NPY2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 367-381 amino acids of human neuropeptide Y receptor Y2